PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1814_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 203aa    MW: 22492.3 Da    PI: 7.6622
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1814_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.11.1e-23153201149
                                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                          +Cqve+C+adls+ak+yhrrhkvC++hska+ +lv  ++qrfCqqCsrf
  cra_locus_1814_iso_1_len_1110_ver_3 153 VCQVEDCRADLSNAKDYHRRHKVCDMHSKATRALVGSVMQRFCQQCSRF 201
                                          6***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-23147201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.102151203IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-22152201IPR004333Transcription factor, SBP-box
PfamPF031101.0E-16154201IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEAKLGGKAL HFCGPVVSDM KAVGKRSIEW DLNDWNWDGD LFTAAPLTSV PSDCRSRQFF  60
PLGSEVPTNT RVSNSFSSGS DELVSGTDKG KRELEKRRRL VDVEDEECVD EVGSLNLKLG  120
GQVYPIAEGD AEKWECKSGK KSKVVGPSSN RAVCQVEDCR ADLSNAKDYH RRHKVCDMHS  180
KATRALVGSV MQRFCQQCSR FVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-22154201653squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KRRRL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011624.12e-89PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_011011632.12e-89PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
TrEMBLA0A068TRT41e-101A0A068TRT4_COFCA; Uncharacterized protein
STRINGPOPTR_0010s16370.15e-87(Populus trichocarpa)